PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00005498.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family FAR1
Protein Properties Length: 635aa    MW: 74436 Da    PI: 8.1278
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00005498.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR148.52.8e-1562149190
                            FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevt 79 
                                     +fY++YA+ +G         +sk+++e+++r+f+C+++g+  +e     +e+r r + r +Cka++ v + ++g ++vt
  FANhyb_rscf00005498.1.g00001.1  62 DFYKKYASALGLLYDLVLVGRSKKTTEFIRREFYCNRQGHGPSELVG--DEKRIRGVVREDCKARMIVVRVNSGGFVVT 138
                                     6***************************************9999877..89999************************* PP

                            FAR1  80 kleleHnHela 90 
                                      +++ H+H+++
  FANhyb_rscf00005498.1.g00001.1 139 IFDEGHTHPMT 149
                                     ********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031017.9E-1362149IPR004330FAR1 DNA binding domain
PfamPF105513.0E-28270362IPR018289MULE transposase domain
PROSITE profilePS5096610.546549586IPR007527Zinc finger, SWIM-type
PfamPF044342.8E-6551580IPR007527Zinc finger, SWIM-type
SMARTSM005756.7E-4561588IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 635 aa     Download sequence    Send to blast
MSVPMELDIN EMLVAEEPKI DPIQVVHPSQ ENISTSAFYP QVRNELKPFK GQQFTTWEEA  60
HDFYKKYASA LGLLYDLVLV GRSKKTTEFI RREFYCNRQG HGPSELVGDE KRIRGVVRED  120
CKARMIVVRV NSGGFVVTIF DEGHTHPMTS PRRLHLVKSN RGFTKAQRSL WEQLSMVNIP  180
PCKQFDILRV QAGGFQYIGC TQQDLYNLER DKRKEKKGQD GDMLHDYLLL EQEKNSRFCF  240
TIKADAENKI THCFWVDAIS RQSYKFYGDV IIFDTTYQTN RYSLIFAPLM GINNHGQTIV  300
FGAAFLSDET TYSFVWLLNE FLNAMLGGAP KMIITDQDPS MEKAISEVLP DTFHRYSSWH  360
ILRMFSEKLD AIKCRDHYEA FRKCIYSSEN EDEFELKWRS VLAESGLSGH NWLQSIYEIR  420
FRWVPAYMNH VFSAGMSSSQ RAESAHSFFK DYVSDKNSLV EFMVQFNRGM LHKRHEELIA  480
DHIDVNEKPR FKCPIKMEKQ MSDIYTRKYY YKFQDQLWES YNYNLKVRSE DENKCTLKVT  540
REDHEDGRAR VIMYDKSKDF ASCTCKLFES AGVPCRHVLA YLHRIHQLHK LPDQYILKRW  600
TKSAKSEVVM DKSGMEITVN KSLLEKRGLL FQQYS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008365955.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLV4URE30.0V4URE3_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-115FAR1-related sequence 5